KRT16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081587
Artikelname: KRT16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081587
Hersteller Artikelnummer: orb2081587
Alternativnummer: BYT-ORB2081587-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-KRT16 antibody is: synthetic peptide directed towards the C-terminal region of Human K1C16
Konjugation: Biotin
Alternative Synonym: K16, PC1, CK16, K1CP, NEPPK, FNEPPK, KRT16A
KRT16 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 52 kDa
NCBI: 005548
UniProt: P08779
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QEYQILLDVKTRLEQEIATYRRLLEGEDAHLSSQQASGQSYSSREVFTSS