KRT16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081587
Article Name: KRT16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081587
Supplier Catalog Number: orb2081587
Alternative Catalog Number: BYT-ORB2081587-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-KRT16 antibody is: synthetic peptide directed towards the C-terminal region of Human K1C16
Conjugation: Biotin
Alternative Names: K16, PC1, CK16, K1CP, NEPPK, FNEPPK, KRT16A
KRT16 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 52 kDa
NCBI: 005548
UniProt: P08779
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QEYQILLDVKTRLEQEIATYRRLLEGEDAHLSSQQASGQSYSSREVFTSS