KLRC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081596
Artikelname: KLRC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081596
Hersteller Artikelnummer: orb2081596
Alternativnummer: BYT-ORB2081596-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-KLRC2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKG2C
Konjugation: Biotin
Alternative Synonym: NKG2C, CD159c, NKG2-C
KLRC2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25 kDa
NCBI: 002251
UniProt: P26717
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ISGTEQEIFQVELNLQNPSLNHQGIDKIYDCQGLLPPPEKLTAEVLGIIC