KLRC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2081596
| Article Name: |
KLRC2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2081596 |
| Supplier Catalog Number: |
orb2081596 |
| Alternative Catalog Number: |
BYT-ORB2081596-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen for Anti-KLRC2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKG2C |
| Conjugation: |
Biotin |
| Alternative Names: |
NKG2C, CD159c, NKG2-C |
| KLRC2 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
25 kDa |
| NCBI: |
002251 |
| UniProt: |
P26717 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: ISGTEQEIFQVELNLQNPSLNHQGIDKIYDCQGLLPPPEKLTAEVLGIIC |
