KIR2DS4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081611
| Artikelname: |
KIR2DS4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081611 |
| Hersteller Artikelnummer: |
orb2081611 |
| Alternativnummer: |
BYT-ORB2081611-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-KIR2DS4 antibody is: synthetic peptide directed towards the C-terminal region of Human KI2S4 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
KKA3, KIR1D, NKAT8, CD158I, KIR412, NKAT-8, KIR-2DS4 |
| KIR2DS4 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
33 kDa |
| NCBI: |
036446 |
| UniProt: |
P43632 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: RDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSV |
