KIR2DS4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2081611
| Article Name: |
KIR2DS4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2081611 |
| Supplier Catalog Number: |
orb2081611 |
| Alternative Catalog Number: |
BYT-ORB2081611-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen for Anti-KIR2DS4 antibody is: synthetic peptide directed towards the C-terminal region of Human KI2S4 |
| Conjugation: |
Biotin |
| Alternative Names: |
KKA3, KIR1D, NKAT8, CD158I, KIR412, NKAT-8, KIR-2DS4 |
| KIR2DS4 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
33 kDa |
| NCBI: |
036446 |
| UniProt: |
P43632 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: RDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSV |
