IFNAR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081638
Artikelname: IFNAR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081638
Hersteller Artikelnummer: orb2081638
Alternativnummer: BYT-ORB2081638-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-IFNAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human INAR2
Konjugation: Biotin
Alternative Synonym: IFN-R, IMD45, IFNABR, IFNARB, IFN-alpha-REC
IFNAR2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 56 kDa
NCBI: 997468
UniProt: P48551
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPRTSGGGYTM