IFNAR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081638
Article Name: IFNAR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081638
Supplier Catalog Number: orb2081638
Alternative Catalog Number: BYT-ORB2081638-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-IFNAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human INAR2
Conjugation: Biotin
Alternative Names: IFN-R, IMD45, IFNABR, IFNARB, IFN-alpha-REC
IFNAR2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 56 kDa
NCBI: 997468
UniProt: P48551
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPRTSGGGYTM