GUCY1A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081674
| Artikelname: |
GUCY1A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081674 |
| Hersteller Artikelnummer: |
orb2081674 |
| Alternativnummer: |
BYT-ORB2081674-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GCYA3 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
GUCA3, MYMY6, GC-SA3, GUC1A3, GUCSA3, GUCY1A3, GCS-alpha-3, GC-S-alpha-1 |
| GUCY1A1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
77kDa |
| NCBI: |
006714260 |
| UniProt: |
Q02108 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVED |