GUCY1A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2081674
| Article Name: |
GUCY1A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2081674 |
| Supplier Catalog Number: |
orb2081674 |
| Alternative Catalog Number: |
BYT-ORB2081674-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GCYA3 |
| Conjugation: |
Biotin |
| Alternative Names: |
GUCA3, MYMY6, GC-SA3, GUC1A3, GUCSA3, GUCY1A3, GCS-alpha-3, GC-S-alpha-1 |
| GUCY1A1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
77kDa |
| NCBI: |
006714260 |
| UniProt: |
Q02108 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: DCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVED |
