EHHADH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081767
Artikelname: EHHADH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081767
Hersteller Artikelnummer: orb2081767
Alternativnummer: BYT-ORB2081767-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ECHP
Konjugation: Biotin
Alternative Synonym: LBP, ECHD, LBFP, MFE1, PBFE, FRTS3, L-PBE
EHHADH Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 001957
UniProt: Q08426
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSGPKPRLTSSVKEL