EHHADH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081767
Article Name: EHHADH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081767
Supplier Catalog Number: orb2081767
Alternative Catalog Number: BYT-ORB2081767-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ECHP
Conjugation: Biotin
Alternative Names: LBP, ECHD, LBFP, MFE1, PBFE, FRTS3, L-PBE
EHHADH Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 001957
UniProt: Q08426
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSGPKPRLTSSVKEL