RUFY2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082157
Artikelname: RUFY2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082157
Hersteller Artikelnummer: orb2082157
Alternativnummer: BYT-ORB2082157-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RUFY2
Konjugation: Biotin
Alternative Synonym: RABIP4R, ZFYVE13
RUFY2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
UniProt: Q8WXA3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDE