RUFY2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082157
Article Name: RUFY2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082157
Supplier Catalog Number: orb2082157
Alternative Catalog Number: BYT-ORB2082157-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RUFY2
Conjugation: Biotin
Alternative Names: RABIP4R, ZFYVE13
RUFY2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 41kDa
UniProt: Q8WXA3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDE