NELFCD Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2082182
Artikelname: NELFCD Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2082182
Hersteller Artikelnummer: orb2082182
Alternativnummer: BYT-ORB2082182-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NELFD
Konjugation: HRP
Alternative Synonym: TH1, TH1L, NELF-C, NELF-D, HSPC130
NELFCD Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
UniProt: Q8IXH7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MAGAVPGAIMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHK