NELFCD Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2082182
Article Name: NELFCD Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082182
Supplier Catalog Number: orb2082182
Alternative Catalog Number: BYT-ORB2082182-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NELFD
Conjugation: HRP
Alternative Names: TH1, TH1L, NELF-C, NELF-D, HSPC130
NELFCD Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 22kDa
UniProt: Q8IXH7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MAGAVPGAIMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHK