PLA2G6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082454
Artikelname: PLA2G6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082454
Hersteller Artikelnummer: orb2082454
Alternativnummer: BYT-ORB2082454-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-PLA2G6 antibody is: synthetic peptide directed towards the C-terminal region of Human PLPL9
Konjugation: Biotin
Alternative Synonym: GVI, PLA2, INAD1, NBIA2, iPLA2, NBIA2A, NBIA2B, PARK14, PNPLA9, CaI-PLA2, IPLA2-VIA, iPLA2beta
PLA2G6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 88 kDa
NCBI: 006724395
UniProt: O60733
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWR