PLA2G6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082454
Article Name: PLA2G6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082454
Supplier Catalog Number: orb2082454
Alternative Catalog Number: BYT-ORB2082454-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-PLA2G6 antibody is: synthetic peptide directed towards the C-terminal region of Human PLPL9
Conjugation: Biotin
Alternative Names: GVI, PLA2, INAD1, NBIA2, iPLA2, NBIA2A, NBIA2B, PARK14, PNPLA9, CaI-PLA2, IPLA2-VIA, iPLA2beta
PLA2G6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 88 kDa
NCBI: 006724395
UniProt: O60733
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWR