HSPA1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082619
Artikelname: HSPA1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082619
Hersteller Artikelnummer: orb2082619
Alternativnummer: BYT-ORB2082619-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HSP71
Konjugation: Biotin
Alternative Synonym: HSP72, HSPA1, HSP70I, HSP70-1, HSP70-2, HSP70.1, HSP70.2, HSP70-1A, HEL-S-103
HSPA1A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 005337
UniProt: P08107
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAV