HSPA1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2082619
| Article Name: |
HSPA1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2082619 |
| Supplier Catalog Number: |
orb2082619 |
| Alternative Catalog Number: |
BYT-ORB2082619-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HSP71 |
| Conjugation: |
Biotin |
| Alternative Names: |
HSP72, HSPA1, HSP70I, HSP70-1, HSP70-2, HSP70.1, HSP70.2, HSP70-1A, HEL-S-103 |
| HSPA1A Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
70kDa |
| NCBI: |
005337 |
| UniProt: |
P08107 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAV |
