MECOM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082637
Artikelname: MECOM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082637
Hersteller Artikelnummer: orb2082637
Alternativnummer: BYT-ORB2082637-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-MECOM antibody is: synthetic peptide directed towards the Middle region of Human EVI1
Konjugation: Biotin
Alternative Synonym: EVI1, MDS1, KMT8E, PRDM3, RUSAT2, MDS1-EVI1, AML1-EVI-1
MECOM Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 114 kDa
UniProt: Q03112
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNVEERMN