MECOM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082637
Article Name: MECOM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082637
Supplier Catalog Number: orb2082637
Alternative Catalog Number: BYT-ORB2082637-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-MECOM antibody is: synthetic peptide directed towards the Middle region of Human EVI1
Conjugation: Biotin
Alternative Names: EVI1, MDS1, KMT8E, PRDM3, RUSAT2, MDS1-EVI1, AML1-EVI-1
MECOM Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 114 kDa
UniProt: Q03112
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNVEERMN