FZR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082775
Artikelname: FZR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082775
Hersteller Artikelnummer: orb2082775
Alternativnummer: BYT-ORB2082775-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FZR
Konjugation: Biotin
Alternative Synonym: FZR, CDH1, FZR2, HCDH, HCDH1, CDC20C
FZR1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 005259630
UniProt: Q9UM11
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAY