FZR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082775
Article Name: FZR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082775
Supplier Catalog Number: orb2082775
Alternative Catalog Number: BYT-ORB2082775-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FZR
Conjugation: Biotin
Alternative Names: FZR, CDH1, FZR2, HCDH, HCDH1, CDC20C
FZR1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 005259630
UniProt: Q9UM11
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAY