DUSP13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082802
Artikelname: DUSP13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082802
Hersteller Artikelnummer: orb2082802
Alternativnummer: BYT-ORB2082802-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-DUSP13 antibody is: synthetic peptide directed towards the N-terminal region of Human DS13B
Konjugation: Biotin
Alternative Synonym: BEDP, MDSP, TMDP, SKRP4, DUSP13A, DUSP13B
DUSP13 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 21 kDa
NCBI: 005269947
UniProt: Q9UII6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVW