DUSP13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082802
Article Name: DUSP13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082802
Supplier Catalog Number: orb2082802
Alternative Catalog Number: BYT-ORB2082802-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-DUSP13 antibody is: synthetic peptide directed towards the N-terminal region of Human DS13B
Conjugation: Biotin
Alternative Names: BEDP, MDSP, TMDP, SKRP4, DUSP13A, DUSP13B
DUSP13 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21 kDa
NCBI: 005269947
UniProt: Q9UII6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVW