ATP6V1B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082889
Artikelname: ATP6V1B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082889
Hersteller Artikelnummer: orb2082889
Alternativnummer: BYT-ORB2082889-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-ATP6V1B1 antibody is: synthetic peptide directed towards the N-terminal region of Human VATB1
Konjugation: Biotin
Alternative Synonym: VATB, VMA2, VPP3, DRTA2, RTA1B, ATP6B1
ATP6V1B1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 56 kDa
NCBI: 001683
UniProt: P15313
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSI