ATP6V1B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082889
Article Name: ATP6V1B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082889
Supplier Catalog Number: orb2082889
Alternative Catalog Number: BYT-ORB2082889-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-ATP6V1B1 antibody is: synthetic peptide directed towards the N-terminal region of Human VATB1
Conjugation: Biotin
Alternative Names: VATB, VMA2, VPP3, DRTA2, RTA1B, ATP6B1
ATP6V1B1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 56 kDa
NCBI: 001683
UniProt: P15313
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSI