ATP5PO Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082892
Artikelname: ATP5PO Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082892
Hersteller Artikelnummer: orb2082892
Alternativnummer: BYT-ORB2082892-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-ATP5O antibody is: synthetic peptide directed towards the N-terminal region of Human ATPO
Konjugation: Biotin
Alternative Synonym: ATPO, OSCP, ATP5O, HMC08D05
ATP5PO Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 23 kDa
NCBI: 001688
UniProt: P48047
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITA