ATP5PO Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082892
Article Name: ATP5PO Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082892
Supplier Catalog Number: orb2082892
Alternative Catalog Number: BYT-ORB2082892-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-ATP5O antibody is: synthetic peptide directed towards the N-terminal region of Human ATPO
Conjugation: Biotin
Alternative Names: ATPO, OSCP, ATP5O, HMC08D05
ATP5PO Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 23 kDa
NCBI: 001688
UniProt: P48047
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITA