ANGPTL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082925
Artikelname: ANGPTL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082925
Hersteller Artikelnummer: orb2082925
Alternativnummer: BYT-ORB2082925-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-ANGPTL3 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL3
Konjugation: Biotin
Alternative Synonym: ANL3, ANG-5, FHBL2, ANGPT5
ANGPTL3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50 kDa
NCBI: 055310
UniProt: Q9Y5C1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLS