ANGPTL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2082925
| Article Name: |
ANGPTL3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2082925 |
| Supplier Catalog Number: |
orb2082925 |
| Alternative Catalog Number: |
BYT-ORB2082925-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen for Anti-ANGPTL3 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL3 |
| Conjugation: |
Biotin |
| Alternative Names: |
ANL3, ANG-5, FHBL2, ANGPT5 |
| ANGPTL3 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
50 kDa |
| NCBI: |
055310 |
| UniProt: |
Q9Y5C1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: WDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLS |
