AGPAT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082940
Artikelname: AGPAT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082940
Hersteller Artikelnummer: orb2082940
Alternativnummer: BYT-ORB2082940-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-AGPAT2 antibody is: synthetic peptide directed towards the middle region of Human PLCB
Konjugation: Biotin
Alternative Synonym: BSCL, BSCL1, LPAAB, 1-AGPAT2, LPAAT-beta
AGPAT2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 30 kDa
NCBI: 006403
UniProt: O15120
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKK