AGPAT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082940
Article Name: AGPAT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082940
Supplier Catalog Number: orb2082940
Alternative Catalog Number: BYT-ORB2082940-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-AGPAT2 antibody is: synthetic peptide directed towards the middle region of Human PLCB
Conjugation: Biotin
Alternative Names: BSCL, BSCL1, LPAAB, 1-AGPAT2, LPAAT-beta
AGPAT2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30 kDa
NCBI: 006403
UniProt: O15120
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKK