SOX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083063
Artikelname: SOX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083063
Hersteller Artikelnummer: orb2083063
Alternativnummer: BYT-ORB2083063-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX4
Konjugation: Biotin
Alternative Synonym: CSS10, EVI16
SOX4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 003098
UniProt: Q06945
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSS