SOX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083063
Article Name: SOX4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083063
Supplier Catalog Number: orb2083063
Alternative Catalog Number: BYT-ORB2083063-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX4
Conjugation: Biotin
Alternative Names: CSS10, EVI16
SOX4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 003098
UniProt: Q06945
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSS