RPGRIP1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083150
Artikelname: RPGRIP1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083150
Hersteller Artikelnummer: orb2083150
Alternativnummer: BYT-ORB2083150-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FTM
Konjugation: Biotin
Alternative Synonym: FTM, MKS5, CORS3, JBTS7, NPHP8, COACH3, PPP1R134
RPGRIP1L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 144kDa
NCBI: 056087
UniProt: Q68CZ1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQ