RPGRIP1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083150
Article Name: RPGRIP1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083150
Supplier Catalog Number: orb2083150
Alternative Catalog Number: BYT-ORB2083150-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FTM
Conjugation: Biotin
Alternative Names: FTM, MKS5, CORS3, JBTS7, NPHP8, COACH3, PPP1R134
RPGRIP1L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 144kDa
NCBI: 056087
UniProt: Q68CZ1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQ