RBCK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083171
Artikelname: RBCK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083171
Hersteller Artikelnummer: orb2083171
Alternativnummer: BYT-ORB2083171-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HOIL1
Konjugation: Biotin
Alternative Synonym: XAP3, XAP4, HOIL1, PBMEI, PGBM1, RBCK2, RNF54, HOIL-1, ZRANB4, C20orf18, UBCE7IP3
RBCK1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
UniProt: Q9BYM8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP