RBCK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083171
Article Name: RBCK1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083171
Supplier Catalog Number: orb2083171
Alternative Catalog Number: BYT-ORB2083171-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HOIL1
Conjugation: Biotin
Alternative Names: XAP3, XAP4, HOIL1, PBMEI, PGBM1, RBCK2, RNF54, HOIL-1, ZRANB4, C20orf18, UBCE7IP3
RBCK1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
UniProt: Q9BYM8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP