NEK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083261
Artikelname: NEK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083261
Hersteller Artikelnummer: orb2083261
Alternativnummer: BYT-ORB2083261-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEK9
Konjugation: Biotin
Alternative Synonym: NC, APUG, NERCC, LCCS10, NERCC1
NEK9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 149107
UniProt: Q8TD19
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLR