NEK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083261
Article Name: NEK9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083261
Supplier Catalog Number: orb2083261
Alternative Catalog Number: BYT-ORB2083261-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEK9
Conjugation: Biotin
Alternative Names: NC, APUG, NERCC, LCCS10, NERCC1
NEK9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 107kDa
NCBI: 149107
UniProt: Q8TD19
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLR