MARK2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083297
Artikelname: MARK2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083297
Hersteller Artikelnummer: orb2083297
Alternativnummer: BYT-ORB2083297-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARK2
Konjugation: Biotin
Alternative Synonym: EMK1, EMK-1, PAR-1, Par1b, Par-1b
MARK2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 86kDa
UniProt: Q7KZI7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKT