MARK2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083297
Article Name: MARK2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083297
Supplier Catalog Number: orb2083297
Alternative Catalog Number: BYT-ORB2083297-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARK2
Conjugation: Biotin
Alternative Names: EMK1, EMK-1, PAR-1, Par1b, Par-1b
MARK2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
UniProt: Q7KZI7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKT