LILRB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083312
Artikelname: LILRB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083312
Hersteller Artikelnummer: orb2083312
Alternativnummer: BYT-ORB2083312-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-LILRB4 antibody is: synthetic peptide directed towards the C-terminal region of Human LIRB4
Konjugation: Biotin
Alternative Synonym: ILT3, LIR5, CD85K, ILT-3, LIR-5
LILRB4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49 kDa
UniProt: Q8NHJ6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAV