LILRB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2083312
| Article Name: |
LILRB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2083312 |
| Supplier Catalog Number: |
orb2083312 |
| Alternative Catalog Number: |
BYT-ORB2083312-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen for Anti-LILRB4 antibody is: synthetic peptide directed towards the C-terminal region of Human LIRB4 |
| Conjugation: |
Biotin |
| Alternative Names: |
ILT3, LIR5, CD85K, ILT-3, LIR-5 |
| LILRB4 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
49 kDa |
| UniProt: |
Q8NHJ6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: RQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAV |
