COX5B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083381
Artikelname: COX5B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083381
Hersteller Artikelnummer: orb2083381
Alternativnummer: BYT-ORB2083381-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human COX5B
Konjugation: Biotin
Alternative Synonym: COXVB
COX5B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 001853
UniProt: P10606
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEED