COX5B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083381
Article Name: COX5B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083381
Supplier Catalog Number: orb2083381
Alternative Catalog Number: BYT-ORB2083381-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human COX5B
Conjugation: Biotin
Alternative Names: COXVB
COX5B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 001853
UniProt: P10606
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEED