IL1RAPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083429
Artikelname: IL1RAPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083429
Hersteller Artikelnummer: orb2083429
Alternativnummer: BYT-ORB2083429-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IRPL1
Konjugation: Biotin
Alternative Synonym: IL1R8, MRX10, MRX21, MRX34, OPHN4, IL1RAPL, TIGIRR-2, IL1RAPL-1, IL-1RAPL-1, IL-1-RAPL-1
IL1RAPL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 76kDa
NCBI: 005274498
UniProt: Q9NZN1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHT