IL1RAPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083429
Article Name: IL1RAPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083429
Supplier Catalog Number: orb2083429
Alternative Catalog Number: BYT-ORB2083429-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IRPL1
Conjugation: Biotin
Alternative Names: IL1R8, MRX10, MRX21, MRX34, OPHN4, IL1RAPL, TIGIRR-2, IL1RAPL-1, IL-1RAPL-1, IL-1-RAPL-1
IL1RAPL1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 005274498
UniProt: Q9NZN1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHT